PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25219s0446.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 717aa    MW: 78823 Da    PI: 5.8273
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25219s0446.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.2e-1965121157
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                           +++ +++t+ q++e+e++F+++++p+ ++r++L+++lgL+  qVk+WFqN+R+++k+
  Bostr.25219s0446.1.p  65 KKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELGLEPLQVKFWFQNKRTQMKN 121
                           688999************************************************995 PP

2START2261.1e-702504632206
                           HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
                 START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                           la +a++el+++a+++ep+W++++  ++++e+ ++f+++ +     +++ea+r+s+vv+m++++ ve+l+d++ qW++ +a    +a+t
  Bostr.25219s0446.1.p 250 LAVAAMEELMRMAQVDEPLWKSLV--LDEEEYARTFPRGIGprpagFRSEASRESAVVIMNHVNIVEILMDVN-QWSTIFAgmvsRAMT 335
                           6789********************..************999********************************.*************** PP

                           EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
                 START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                           l+v+s+g      galq+m+ae+q++splvp R+ +f+Ry++q+g+g+w++vd+S+ds q++p     +R++++ Sg+li++++ng+sk
  Bostr.25219s0446.1.p 336 LAVLSTGvagnfhGALQVMTAEFQVPSPLVPtRETYFARYCKQQGDGSWAVVDISLDSLQPNPP----ARCRRRASGCLIQEMPNGYSK 420
                           ***************************************************************8....********************* PP

                           EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           vtwvehv++++r +h+l++++v++g+a+gak+wva l+rqce+
  Bostr.25219s0446.1.p 421 VTWVEHVEVDDRGVHNLYKHMVSTGHAFGAKRWVAILDRQCER 463
                           *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2143120IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1953122IPR009057Homeodomain-like
PROSITE profilePS5007116.47162122IPR001356Homeobox domain
SMARTSM003891.6E-1863126IPR001356Homeobox domain
CDDcd000868.25E-1965123No hitNo description
PfamPF000463.2E-1765120IPR001356Homeobox domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PROSITE profilePS5084841.829240466IPR002913START domain
SuperFamilySSF559615.07E-33240465No hitNo description
CDDcd088753.17E-123244462No hitNo description
SMARTSM002349.3E-61249463IPR002913START domain
PfamPF018527.3E-63250463IPR002913START domain
Gene3DG3DSA:3.30.530.201.2E-4346429IPR023393START-like domain
SuperFamilySSF559611.45E-26482708No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MFEPNMLLAA MNNTDSNNHN YNHEDNNNEG FLRDDELDSA NTKSGSENQE GGSGNDQDPL  60
HPNKKKRYHR HTQLQIQEME AFFKECPHPD DKQRKQLSRE LGLEPLQVKF WFQNKRTQMK  120
NHHERHENSH LRAENEKLRS DNLRYREALA NASCPNCGGP TAIGEMSFDE HQLRLENARL  180
REEIDRISAI AAKYVGKPVS NYPLMSPPPL PPRPLELSMG GGEAYGNNPT DLLKSITAPT  240
EADKPVIIDL AVAAMEELMR MAQVDEPLWK SLVLDEEEYA RTFPRGIGPR PAGFRSEASR  300
ESAVVIMNHV NIVEILMDVN QWSTIFAGMV SRAMTLAVLS TGVAGNFHGA LQVMTAEFQV  360
PSPLVPTRET YFARYCKQQG DGSWAVVDIS LDSLQPNPPA RCRRRASGCL IQEMPNGYSK  420
VTWVEHVEVD DRGVHNLYKH MVSTGHAFGA KRWVAILDRQ CERLASVMAT NISSGEVGVI  480
TNQEGRRSML KLAERMVISF CAGVSASTAH TWTTLSGTGA EDVRVMTRKS VDDPGRPPGI  540
VLSAATSFWI PVPPKRVFDF LRDENSRNEW DILSNGGVVQ EMAHIANGRE TGNCVSLLRV  600
NSANSSQSNM LILQESCTDP TASFVIYAPV DIVAMNIVLN GGDPDYVALL PSGFAILPDG  660
NANGGGDGGS LLTVAFQILV DSVPTAKLSL GSVATVNNLI ACTVERIKAS MSCETS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167760.0AK316776.1 Arabidopsis thaliana AT1G05230 mRNA, complete cds, clone: RAFL09-78-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001184911.10.0homeobox-leucine zipper protein HDG2
RefseqNP_172015.10.0homeobox-leucine zipper protein HDG2
RefseqNP_849596.10.0homeobox-leucine zipper protein HDG2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLB9DFH80.0B9DFH8_ARATH; AT1G05230 protein
STRINGAT1G05230.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2